PFDN2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12269T
Artikelname: PFDN2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12269T
Hersteller Artikelnummer: CNA12269T
Alternativnummer: MBL-CNA12269T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human PFDN2 (NP_036526.2).
Konjugation: Unconjugated
Alternative Synonym: PFD2
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 5202
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Target-Kategorie: PFDN2
Application Verdünnung: WB: WB,1:1000 - 1:5000