AP2S1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12270T
Artikelname: AP2S1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12270T
Hersteller Artikelnummer: CNA12270T
Alternativnummer: MBL-CNA12270T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human AP2S1 (NP_004060.2).
Konjugation: Unconjugated
Alternative Synonym: AP17, FBH3, HHC3, FBHOk, CLAPS2
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 1175
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Target-Kategorie: AP2S1
Application Verdünnung: WB: WB,1:500 - 1:2000