ERH Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12271T
Artikelname: ERH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12271T
Hersteller Artikelnummer: CNA12271T
Alternativnummer: MBL-CNA12271T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human ERH (NP_004441.1).
Konjugation: Unconjugated
Alternative Synonym: DROER
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 2079
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Target-Kategorie: ERH
Application Verdünnung: WB: WB,1:500 - 1:2000