DPYSL3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12280T
Artikelname: DPYSL3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12280T
Hersteller Artikelnummer: CNA12280T
Alternativnummer: MBL-CNA12280T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 440-520 of human DPYSL3 (NP_001378.1).
Konjugation: Unconjugated
Alternative Synonym: DRP3, ULIP, CRMP4, DRP-3, LCRMP, CRMP-4, ULIP-1
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 1809
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSAR
Target-Kategorie: DPYSL3
Application Verdünnung: WB: WB,1:500 - 1:2000