MERTK Rabbit mAb, Clone: [ARC0229], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12294S
Artikelname: MERTK Rabbit mAb, Clone: [ARC0229], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12294S
Hersteller Artikelnummer: CNA12294S
Alternativnummer: MBL-CNA12294S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MERTK (Q12866).
Konjugation: Unconjugated
Alternative Synonym: MER, RP38, c-Eyk, c-mer, Tyro12
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0229]
Molekulargewicht: 110kDa
NCBI: 10461
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGPAPLPLLLGLFLPALWRRAITEAREEAKPYPLFPGPFPGSLQTDHTPLLSLPHASGYQPALMFSPTQPGRPHTGNVAIPQVTSVESKPLPPLAFKHTV
Target-Kategorie: MERTK
Application Verdünnung: WB: WB,1:500 - 1:1000