SLC12A7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12299T
Artikelname: SLC12A7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12299T
Hersteller Artikelnummer: CNA12299T
Alternativnummer: MBL-CNA12299T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SLC12A7 (NP_006589.2).
Konjugation: Unconjugated
Alternative Synonym: KCC4
Klonalität: Polyclonal
Molekulargewicht: 119kDa
NCBI: 10723
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQESFFEGKNMA
Target-Kategorie: SLC12A7
Application Verdünnung: WB: WB,1:500 - 1:2000