SNPH Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12300T
Artikelname: SNPH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12300T
Hersteller Artikelnummer: CNA12300T
Alternativnummer: MBL-CNA12300T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-425 of human SNPH (NP_055538.2).
Konjugation: Unconjugated
Alternative Synonym: SNPH,bA314N13.5
Klonalität: Polyclonal
Molekulargewicht: 54kDa
NCBI: 9751
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRCPELDAHPSGPRDPNSAVVVTVGDELEAPEPITRGPTPQRPGANPNPGQSVSVVCPMEEEEEAAVAEKEPKSYWSRHY
Target-Kategorie: SNPH
Application Verdünnung: WB: WB,1:500 - 1:2000