RAB5A Rabbit mAb, Clone: [ARC0297], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12304S
Artikelname: RAB5A Rabbit mAb, Clone: [ARC0297], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12304S
Hersteller Artikelnummer: CNA12304S
Alternativnummer: MBL-CNA12304S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 116-215 of human RAB5AA (P20339).
Konjugation: Unconjugated
Alternative Synonym: RAB5
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0297]
Molekulargewicht: 24kDa
NCBI: 5868
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Target-Kategorie: RAB5A
Application Verdünnung: WB: WB,1:500 - 1:1000