NOX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12309T
Artikelname: NOX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12309T
Hersteller Artikelnummer: CNA12309T
Alternativnummer: MBL-CNA12309T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NOX1 (NP_008983.2).
Konjugation: Unconjugated
Alternative Synonym: MOX1, NOH1, NOH-1, GP91-2, NOH-1L
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 27035
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
Target-Kategorie: NOX1
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200