PGE receptor EP1 (PTGER1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12310T
Artikelname: PGE receptor EP1 (PTGER1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12310T
Hersteller Artikelnummer: CNA12310T
Alternativnummer: MBL-CNA12310T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PGE receptor EP1 (PGE receptor EP1 (PTGER1)) (NP_000946.2).
Konjugation: Unconjugated
Alternative Synonym: EP1
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 5731
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VGIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLRQLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLS
Target-Kategorie: PTGER1
Application Verdünnung: WB: WB,1:500 - 1:2000