MAP1LC3A Rabbit mAb, Clone: [ARC2636], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12319S
Artikelname: MAP1LC3A Rabbit mAb, Clone: [ARC2636], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12319S
Hersteller Artikelnummer: CNA12319S
Alternativnummer: MBL-CNA12319S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (Q9H492).
Konjugation: Unconjugated
Alternative Synonym: LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2636]
Molekulargewicht: 14kDa
NCBI: 84557
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Target-Kategorie: MAP1LC3A
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:50- 1:1200