CDC20 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1231S
Artikelname: CDC20 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1231S
Hersteller Artikelnummer: CNA1231S
Alternativnummer: MBL-CNA1231S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human CDC20 (NP_001246.2).
Konjugation: Unconjugated
Alternative Synonym: CDC20A, OOMD14, p55CDC, OZEMA14, bA276H19.3
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 991
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWD
Target-Kategorie: CDC20
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200