MFGE8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12322T
Artikelname: MFGE8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12322T
Hersteller Artikelnummer: CNA12322T
Alternativnummer: MBL-CNA12322T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MFGE8 (NP_001108086.1).
Konjugation: Unconjugated
Alternative Synonym: BA46, HMFG, MFGM, SED1, hP47, EDIL1, MFG-E8, SPAG10, OAcGD3S, HsT19888
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 4240
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPRPRLLAALCGALLCAPSLLVALDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPV
Target-Kategorie: MFGE8
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200