Dot1L/KMT4 Rabbit mAb, Clone: [ARC0688], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12329S
Artikelname: Dot1L/KMT4 Rabbit mAb, Clone: [ARC0688], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12329S
Hersteller Artikelnummer: CNA12329S
Alternativnummer: MBL-CNA12329S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Dot1L/KMT4 (NP_115871.1).
Konjugation: Unconjugated
Alternative Synonym: DOT1, KMT4
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0688]
Molekulargewicht: 165kDa
NCBI: 84444
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNT
Target-Kategorie: DOT1L
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000