VEGFR3/FLT4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12332T
Artikelname: VEGFR3/FLT4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12332T
Hersteller Artikelnummer: CNA12332T
Alternativnummer: MBL-CNA12332T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1200-1300 of human VEGFR3/FLT4 (NP_891555.2).
Konjugation: Unconjugated
Alternative Synonym: PCL, CHTD7, FLT-4, FLT41, LMPH1A, LMPHM1, VEGFR3, VEGFR-3
Klonalität: Polyclonal
Molekulargewicht: 153kDa
NCBI: 2324
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCK
Target-Kategorie: FLT4
Application Verdünnung: WB: WB,1:500 - 1:2000