ACSS2 Rabbit mAb, Clone: [ARC0690], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12334S
Artikelname: ACSS2 Rabbit mAb, Clone: [ARC0690], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12334S
Hersteller Artikelnummer: CNA12334S
Alternativnummer: MBL-CNA12334S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ACSS2 (Q9NR19).
Konjugation: Unconjugated
Alternative Synonym: ACS, ACSA, ACAS2, ACECS, AceCS1, dJ1161H23.1
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0690]
Molekulargewicht: 79kDa
NCBI: 55902
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: LHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSN
Target-Kategorie: ACSS2
Application Verdünnung: WB: WB,1:500 - 1:1000