SBF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12354T
Artikelname: SBF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12354T
Hersteller Artikelnummer: CNA12354T
Alternativnummer: MBL-CNA12354T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1630-1770 of human SBF1 (NP_002963.2).
Konjugation: Unconjugated
Alternative Synonym: MTMR5, CMT4B3, DENND7A
Klonalität: Polyclonal
Molekulargewicht: 208kDa
NCBI: 6305
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PPYDWELAQGPPEPPEEERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGQPAERWKDTWDRVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTTSGSRQAAR
Target-Kategorie: SBF1
Application Verdünnung: WB: WB,1:500 - 1:2000