STAT5B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12356T
Artikelname: STAT5B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12356T
Hersteller Artikelnummer: CNA12356T
Alternativnummer: MBL-CNA12356T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 700-787 of human STAT5B (NP_036580.2).
Konjugation: Unconjugated
Alternative Synonym: STAT5, GHISID2
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 6777
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: VKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS
Target-Kategorie: STAT5B
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200