SULT1A3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12357T
Artikelname: SULT1A3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12357T
Hersteller Artikelnummer: CNA12357T
Alternativnummer: MBL-CNA12357T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SULT1A3 (NP_808220.1).
Konjugation: Unconjugated
Alternative Synonym: STM, HAST, HAST3, M-PST, ST1A3, ST1A4, ST1A5, TL-PST, ST1A3/ST1A4
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 6818
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTP
Target-Kategorie: SULT1A3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:100