AICDA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12372T
Artikelname: AICDA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12372T
Hersteller Artikelnummer: CNA12372T
Alternativnummer: MBL-CNA12372T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 17-130 of human AICDA (NP_065712.1).
Konjugation: Unconjugated
Alternative Synonym: AID, ARP2, CDA2, HIGM2, HEL-S-284
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 57379
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: NVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLH
Target-Kategorie: AICDA
Application Verdünnung: WB: WB,1:500 - 1:2000