GEMIN6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12375T
Artikelname: GEMIN6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12375T
Hersteller Artikelnummer: CNA12375T
Alternativnummer: MBL-CNA12375T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-167 of human GEMIN6 (NP_079051.9).
Konjugation: Unconjugated
Alternative Synonym: GEMIN6
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 79833
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGIMGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ
Target-Kategorie: GEMIN6
Application Verdünnung: WB: WB,1:500 - 1:2000