CD3D Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1238S
Artikelname: CD3D Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1238S
Hersteller Artikelnummer: CNA1238S
Alternativnummer: MBL-CNA1238S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-105 of human CD3D (NP_000723.1).
Konjugation: Unconjugated
Alternative Synonym: T3D, IMD19, CD3DELTA, CD3-DELTA
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 915
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
Target-Kategorie: CD3D
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100