CGA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1239S
Artikelname: CGA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1239S
Hersteller Artikelnummer: CNA1239S
Alternativnummer: MBL-CNA1239S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-116 of human CGA (NP_000726.1).
Konjugation: Unconjugated
Alternative Synonym: HCG, LHA, FSHA, GPA1, GPHa, TSHA, GPHA1, CG-ALPHA
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 1081
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Target-Kategorie: CGA
Application Verdünnung: WB: WB,1:500 - 1:2000