DNA topoisomerase I (TOP1) Rabbit mAb, Clone: [ARC0708], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12409S
Artikelname: DNA topoisomerase I (TOP1) Rabbit mAb, Clone: [ARC0708], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12409S
Hersteller Artikelnummer: CNA12409S
Alternativnummer: MBL-CNA12409S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (TOP1) (P11387).
Konjugation: Unconjugated
Alternative Synonym: TOPI
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0708]
Molekulargewicht: 91kDa
NCBI: 7150
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Target-Kategorie: TOP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000