CD3E Antigen Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12415S
Artikelname: CD3E Antigen Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12415S
Hersteller Artikelnummer: CNA12415S
Alternativnummer: MBL-CNA12415S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human CD3E Antigen (NP_000724.1).
Konjugation: Unconjugated
Alternative Synonym: T3E, TCRE, IMD18, CD3epsilon
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 916
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Target-Kategorie: CD3E
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200