Clathrin heavy chain Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12423T
Artikelname: Clathrin heavy chain Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12423T
Hersteller Artikelnummer: CNA12423T
Alternativnummer: MBL-CNA12423T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1451-1675 of human Clathrin heavy chain (NP_004850.1).
Konjugation: Unconjugated
Alternative Synonym: Hc, CHC, CHC17, MRD56, CLH-17, CLTCL2
Klonalität: Polyclonal
Molekulargewicht: 192kDa
NCBI: 1213
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: YLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
Target-Kategorie: CLTC
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200