PCNA Rabbit mAb, Clone: [ARC51324], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12427P
Artikelname: PCNA Rabbit mAb, Clone: [ARC51324], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12427P
Hersteller Artikelnummer: CNA12427P
Alternativnummer: MBL-CNA12427P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Monkey, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1).
Konjugation: Unconjugated
Alternative Synonym: ATLD2
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51324]
Molekulargewicht: 29kDa
NCBI: 5111
Puffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequenz: CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Target-Kategorie: PCNA
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:2000 - 1:10000|IF/ICC,1:50 - 1:200