FLT3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12437S
Artikelname: FLT3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12437S
Hersteller Artikelnummer: CNA12437S
Alternativnummer: MBL-CNA12437S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 650-750 of human FLT3 (NP_004110.2).
Konjugation: Unconjugated
Alternative Synonym: FLK2, STK1, CD135, FLK-2
Klonalität: Polyclonal
Molekulargewicht: 113kDa
NCBI: 2322
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ADSSEREALMSELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSD
Target-Kategorie: FLT3
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200