Granulin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12440S
Artikelname: Granulin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12440S
Hersteller Artikelnummer: CNA12440S
Alternativnummer: MBL-CNA12440S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 281-336 of human Granulin (NP_002078.1).
Konjugation: Unconjugated
Alternative Synonym: GEP, GP88, PEPI, PGRN, CLN11, PCDGF
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 2896
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCE
Target-Kategorie: GRN
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200