[KO Validated] Histone H2A.Z Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12442S
Artikelname: [KO Validated] Histone H2A.Z Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12442S
Hersteller Artikelnummer: CNA12442S
Alternativnummer: MBL-CNA12442S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFZ (NP_002097.1).
Konjugation: Unconjugated
Alternative Synonym: H2AZ, H2A.z, H2A/z, H2AFZ, H2A.Z-1
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 3015
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
Target-Kategorie: H2AZ1
Application Verdünnung: WB: WB,1:500 - 1:2000