HLA-DRB3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12444S
Artikelname: HLA-DRB3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12444S
Hersteller Artikelnummer: CNA12444S
Alternativnummer: MBL-CNA12444S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-227 of human HLA-DRB3 (NP_072049.2).
Konjugation: Unconjugated
Alternative Synonym: DRB3, HLA-DPB1, HLA-DR1B, HLA-DR3B, HLA-DRB3*
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 3125
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSK
Target-Kategorie: HLA-DRB3
Application Verdünnung: WB: WB,1:500 - 1:2000