IGFBP5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12451S
Artikelname: IGFBP5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12451S
Hersteller Artikelnummer: CNA12451S
Alternativnummer: MBL-CNA12451S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 68-167 of human IGFBP5 (NP_000590.1).
Konjugation: Unconjugated
Alternative Synonym: IBP5
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 3488
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVG
Target-Kategorie: IGFBP5
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200