IL17A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12454P
Artikelname: IL17A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12454P
Hersteller Artikelnummer: CNA12454P
Alternativnummer: MBL-CNA12454P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL17A (NP_002181.1).
Konjugation: Unconjugated
Alternative Synonym: IL17, CTLA8, IL-17, ILA17, CTLA-8, IL-17A
Klonalität: Polyclonal
Molekulargewicht: 18kDa
NCBI: 3605
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCI
Target-Kategorie: IL17A
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:300