KTN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA12456S
| Artikelname: |
KTN1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA12456S |
| Hersteller Artikelnummer: |
CNA12456S |
| Alternativnummer: |
MBL-CNA12456S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KTN1 (NP_001072989.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
CG1, KNT, MU-RMS-40.19 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
156kDa |
| NCBI: |
3895 |
| Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequenz: |
MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV |
| Target-Kategorie: |
KTN1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
