MEK5 Rabbit mAb, Clone: [ARC0711], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA12457S
| Artikelname: |
MEK5 Rabbit mAb, Clone: [ARC0711], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA12457S |
| Hersteller Artikelnummer: |
CNA12457S |
| Alternativnummer: |
MBL-CNA12457S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human MEK5 (Q13163). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
MEK5 |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0711] |
| Molekulargewicht: |
50kDa |
| NCBI: |
5607 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
DVYRKMPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA |
| Target-Kategorie: |
MAP2K5 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
