MAP3K5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12458T
Artikelname: MAP3K5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12458T
Hersteller Artikelnummer: CNA12458T
Alternativnummer: MBL-CNA12458T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human MAP3K5 (NP_005914.1).
Konjugation: Unconjugated
Alternative Synonym: ASK1, MEKK5, MAPKKK5
Klonalität: Polyclonal
Molekulargewicht: 155kDa
NCBI: 4217
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFR
Target-Kategorie: MAP3K5
Application Verdünnung: WB: WB,1:500 - 1:1000