PPP1CA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12468P
Artikelname: PPP1CA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12468P
Hersteller Artikelnummer: CNA12468P
Alternativnummer: MBL-CNA12468P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-330 of human PPP1CA (NP_002699.1).
Konjugation: Unconjugated
Alternative Synonym: PP1A, PP-1A, PPP1A, PP1alpha
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 5499
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDG
Target-Kategorie: PPP1CA
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200