MYO10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12471S
Artikelname: MYO10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12471S
Hersteller Artikelnummer: CNA12471S
Alternativnummer: MBL-CNA12471S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2).
Konjugation: Unconjugated
Alternative Synonym: MyoX
Klonalität: Polyclonal
Molekulargewicht: 237kDa
NCBI: 4651
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES
Target-Kategorie: MYO10
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200