CLDN11 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12478P
Artikelname: CLDN11 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12478P
Hersteller Artikelnummer: CNA12478P
Alternativnummer: MBL-CNA12478P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN11 (NP_005593.2).
Konjugation: Unconjugated
Alternative Synonym: OSP, OTM, HLD22
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 5010
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLL
Target-Kategorie: CLDN11
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100