PSMD13 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12485S
Artikelname: PSMD13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12485S
Hersteller Artikelnummer: CNA12485S
Alternativnummer: MBL-CNA12485S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human PSMD13 (NP_002808.3).
Konjugation: Unconjugated
Alternative Synonym: S11, Rpn9, p40.5, HSPC027
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 5719
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQT
Target-Kategorie: PSMD13
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200