eIF4EBP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1248P
Artikelname: eIF4EBP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1248P
Hersteller Artikelnummer: CNA1248P
Alternativnummer: MBL-CNA1248P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human eIF4EBP1 (NP_004086.1).
Konjugation: Unconjugated
Alternative Synonym: BP-1, 4EBP1, 4E-BP1, PHAS-I
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 1978
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: TRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Target-Kategorie: EIF4EBP1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:200