RBP4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12495S
Artikelname: RBP4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12495S
Hersteller Artikelnummer: CNA12495S
Alternativnummer: MBL-CNA12495S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-201 of human RBP4 (NP_006735.2).
Konjugation: Unconjugated
Alternative Synonym: RDCCAS, MCOPCB10
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 5950
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Target-Kategorie: RBP4
Application Verdünnung: WB: WB,1:500 - 1:2000