SLC1A4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12507S
Artikelname: SLC1A4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12507S
Hersteller Artikelnummer: CNA12507S
Alternativnummer: MBL-CNA12507S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human SLC1A4 (NP_003029.2).
Konjugation: Unconjugated
Alternative Synonym: SATT, ASCT1, SPATCCM
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 6509
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHEKIPIGTEIEG
Target-Kategorie: SLC1A4
Application Verdünnung: WB: WB,1:500 - 1:2000