STXBP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12511S
Artikelname: STXBP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12511S
Hersteller Artikelnummer: CNA12511S
Alternativnummer: MBL-CNA12511S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human STXBP2 (NP_001120868.1).
Konjugation: Unconjugated
Alternative Synonym: FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, unc-18B, MUNC18-2
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 6813
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAPSGLKAVVGEKILSGVIRSVKKDGEWKVLIMDHPSMRILSSCCKMSDILAEGITIVEDINKRREPIPSLEAIYLLSPTEKALIKDFQGTPTFTYKAAHIFFTDTCPEPLFSELGRSRLAKVVKTLKEIHLAFLPYEAQVFSLDAPHSTYNLYCPFRAEERTRQLEVLAQQIATLCATLQEYPAIRYRKGPEDTAQLAHAVLAKLNAFKADTPSLGEGPEKTRSQLLIMDRAADPVSPLLHELTFQAMAYDLL
Target-Kategorie: STXBP2
Application Verdünnung: WB: WB,1:500 - 1:2000