CD62P/P-selectin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12512S
Artikelname: CD62P/P-selectin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12512S
Hersteller Artikelnummer: CNA12512S
Alternativnummer: MBL-CNA12512S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 220-319 of human CD62P/P-selectin (NP_002996.2).
Konjugation: Unconjugated
Alternative Synonym: CD62, GRMP, PSEL, CD62P, GMP140, LECAM3, PADGEM
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 6403
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: FSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVC
Target-Kategorie: SELP
Application Verdünnung: WB: WB,1:500 - 1:2000