TIA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12523S
Artikelname: TIA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12523S
Hersteller Artikelnummer: CNA12523S
Alternativnummer: MBL-CNA12523S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human TIA1 (NP_071505.2).
Konjugation: Unconjugated
Alternative Synonym: WDM, ALS26, TIA-1
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 7072
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
Target-Kategorie: TIA1
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200