DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12524S
Artikelname: DNA topoisomerase I (TOP1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12524S
Hersteller Artikelnummer: CNA12524S
Alternativnummer: MBL-CNA12524S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DNA topoisomerase I (DNA topoisomerase I (TOP1)) (NP_003277.1).
Konjugation: Unconjugated
Alternative Synonym: TOPI
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 7150
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDA
Target-Kategorie: TOP1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:20 - 1:50