TRPC1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12525S
Artikelname: TRPC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12525S
Hersteller Artikelnummer: CNA12525S
Alternativnummer: MBL-CNA12525S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (NP_001238774.1).
Konjugation: Unconjugated
Alternative Synonym: TRP1, HTRP-1
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 7220
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG
Target-Kategorie: TRPC1
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200