VEGFC Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12530S
Artikelname: VEGFC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12530S
Hersteller Artikelnummer: CNA12530S
Alternativnummer: MBL-CNA12530S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human VEGFC (NP_005420.1).
Konjugation: Unconjugated
Alternative Synonym: VRP, Flt4-L, LMPH1D, LMPHM4
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 7424
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLR
Target-Kategorie: VEGFC
Application Verdünnung: WB: WB,1:500 - 1:1000