VIP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12531S
Artikelname: VIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12531S
Hersteller Artikelnummer: CNA12531S
Alternativnummer: MBL-CNA12531S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-170 of human VIP (NP_003372.1).
Konjugation: Unconjugated
Alternative Synonym: PHM27
Klonalität: Polyclonal
Molekulargewicht: 19kDa
NCBI: 7432
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: APSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK
Target-Kategorie: VIP
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200